Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50010530 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_146989 |
---|
IC50 | 6000±n/a nM |
---|
Citation | Yoshino, H; Nakazawa, T; Arakawa, Y; Kaneko, T; Tsuchiya, Y; Matsunaga, M; Araki, S; Ikeda, M; Yamatsu, K; Tachibana, S Synthesis and structure-activity relationships of dynorphin A-(1-8) amide analogues. J Med Chem33:206-12 (1990) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50010530 |
---|
n/a |
---|
Name | BDBM50010530 |
Synonyms: | 2-[5-Guanidino-2-(5-guanidino-2-{2-[2-(2-{2-[3-(4-hydroxy-phenyl)-2-methylamino-propionylamino]-acetylamino}-acetylamino)-3-phenyl-propionylamino]-propionylamino}-pentanoylamino)-pentanoylamino]-4-methyl-pentanoic acid amide | CHEMBL306016 |
Type | Small organic molecule |
Emp. Form. | C44H69N15O9 |
Mol. Mass. | 952.1138 |
SMILES | CN[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)NCC(=O)N[C@H](Cc1ccccc1)C(=O)N[C@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(N)=O |
Structure |
|