Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-lipoxygenase/FLAP
LigandBDBM50261982
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1696510
IC50 2.4±n/a nM
Citation Bartolozzi AAbeywardane ABosanac TBroadwater JAChen ZHutzler JMHuber JDNemoto POlague ARiether DSimpson TTakahashi HWu LZhang YZindell RM Discovery and optimization of oxadiazole-based FLAP inhibitors. Bioorg Med Chem Lett 27:4652-4659 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-lipoxygenase/FLAP
Name:5-lipoxygenase/FLAP
Synonyms:5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | FLAP | MK-886-binding protein
Type:Enzyme
Mol. Mass.:18159.90
Organism:Homo sapiens (Human)
Description:P20292
Residue:161
Sequence:
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50261982
n/a
NameBDBM50261982
Synonyms:CHEMBL4094923
TypeSmall organic molecule
Emp. Form.C20H19N7O
Mol. Mass.373.4112
SMILESCc1cc([nH]n1)-c1nc(no1)C1(CCC1)c1ccc(cc1)-c1cnc(N)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: