Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-lipoxygenase/FLAP
LigandBDBM50262010
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1696511
IC50 37±n/a nM
Citation Bartolozzi AAbeywardane ABosanac TBroadwater JAChen ZHutzler JMHuber JDNemoto POlague ARiether DSimpson TTakahashi HWu LZhang YZindell RM Discovery and optimization of oxadiazole-based FLAP inhibitors. Bioorg Med Chem Lett 27:4652-4659 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-lipoxygenase/FLAP
Name:5-lipoxygenase/FLAP
Synonyms:5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | FLAP | MK-886-binding protein
Type:Enzyme
Mol. Mass.:18159.90
Organism:Homo sapiens (Human)
Description:P20292
Residue:161
Sequence:
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50262010
n/a
NameBDBM50262010
Synonyms:CHEMBL4080876
TypeSmall organic molecule
Emp. Form.C22H20N8O
Mol. Mass.412.4472
SMILESNc1ncc(cn1)-c1ccc(cc1)C1(CCC1)c1noc(n1)-c1cnn(CCC#N)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: