Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor
LigandBDBM21220
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1697703
EC50 16±n/a nM
Citation Aurelio LBaltos JAFord LNguyen ATNJörg MDevine SMValant CWhite PJChristopoulos AMay LTScammells PJ A Structure-Activity Relationship Study of Bitopic N J Med Chem 61:2087-2103 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor
Name:Adenosine receptor
Synonyms:ADENOSINE A2B | ADORA2B | Adenosine receptor A2B (A2B)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36341.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:332
Sequence:
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21220
n/a
NameBDBM21220
Synonyms:(2S,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-N-ethyl-3,4-dihydroxyoxolane-2-carboxamide | Adenosine analog, 3 | Adenosine, N6-Ethyl-carboxamido | Adenosine-5-(N-ethylcarboxamide) | CHEMBL464859 | N-Ethylcarboxamidoadenosine | NECA
TypeAntineoplastic Agent
Emp. Form.C12H16N6O4
Mol. Mass.308.2932
SMILESCCNC(=O)[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: