Reaction Details |
| Report a problem with these data |
Target | Melanocyte-stimulating hormone receptor |
---|
Ligand | BDBM50027084 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1698288 (CHEMBL4049178) |
---|
Ki | 0.112202±n/a nM |
---|
Citation | Durek, T; Cromm, PM; White, AM; Schroeder, CI; Kaas, Q; Weidmann, J; Ahmad Fuaad, A; Cheneval, O; Harvey, PJ; Daly, NL; Zhou, Y; Dellsén, A; Österlund, T; Larsson, N; Knerr, L; Bauer, U; Kessler, H; Cai, M; Hruby, VJ; Plowright, AT; Craik, DJ Development of Novel Melanocortin Receptor Agonists Based on the Cyclic Peptide Framework of Sunflower Trypsin Inhibitor-1. J Med Chem61:3674-3684 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanocyte-stimulating hormone receptor |
---|
Name: | Melanocyte-stimulating hormone receptor |
Synonyms: | MC1-R | MC1R | MSH-R | MSHR | MSHR_HUMAN | Melanocortin MC1 | Melanocortin receptor (M1 and M4) | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R) |
Type: | Enzyme |
Mol. Mass.: | 34717.23 |
Organism: | Homo sapiens (Human) |
Description: | Q01726 |
Residue: | 317 |
Sequence: | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
|
|
|
BDBM50027084 |
---|
n/a |
---|
Name | BDBM50027084 |
Synonyms: | Melatonan |
Type | Small organic molecule |
Emp. Form. | C50H69N15O9 |
Mol. Mass. | 1024.178 |
SMILES | CCCC[C@H](NC(C)=O)C(=O)N[C@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2cnc[nH]2)NC1=O)C(N)=O |r| |
Structure |
|