Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50011612
Substrate/Competitorn/a
Meas. Tech.ChEBML_56498
IC50 6±n/a nM
Citation Walser AFlynn TMason CCrowley HMaresca CYaremko BO'Donnell M Triazolobenzo- and triazolothienodiazepines as potent antagonists of platelet activating factor. J Med Chem 34:1209-21 (1991) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF Platelet activating factor | PAF-R | Platelet-activating factor receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39219.60
Organism:Homo sapiens (Human)
Description:PAF Platelet activating factor PTAFR HUMAN::P25105
Residue:342
Sequence:
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011612
n/a
NameBDBM50011612
Synonyms:1-{3-[6-(2-Fluoro-phenyl)-1,4-dimethyl-4H-2,3,5,10b-tetraaza-benzo[e]azulen-8-yl]-prop-2-ynyl}-3,4-dihydro-1H-quinolin-2-one | CHEMBL277246
TypeSmall organic molecule
Emp. Form.C30H24FN5O
Mol. Mass.489.5429
SMILESC[C@@H]1N=C(c2ccccc2F)c2cc(ccc2-n2c(C)nnc12)C#CCN1C(=O)CCc2ccccc12 |t:2|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: