Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50010497 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158640 (CHEMBL763244) |
---|
IC50 | 65.0±n/a nM |
---|
Citation | Rich, DH; Sun, CQ; Vara Prasad, JV; Pathiasseril, A; Toth, MV; Marshall, GR; Clare, M; Mueller, RA; Houseman, K Effect of hydroxyl group configuration in hydroxyethylamine dipeptide isosteres on HIV protease inhibition. Evidence for multiple binding modes. J Med Chem34:1222-5 (1991) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50010497 |
---|
n/a |
---|
Name | BDBM50010497 |
Synonyms: | Acetyl-Ser-Leu-Asn-Phe-[S]-[CH(OH)CH2N]Pro-Ile-Val-OMe | CHEMBL109500 |
Type | Small organic molecule |
Emp. Form. | C42H68N8O11 |
Mol. Mass. | 861.0363 |
SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C[C@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(C)=O)C(=O)N[C@@H](C(C)C)C(=O)OC |
Structure |
|