Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin G
LigandBDBM50014746
Substrate/Competitorn/a
Meas. Tech.ChEBML_45359
Ki 1100±n/a nM
Citation Peet NPBurkhart JPAngelastro MRGiroux ELMehdi SBey PKolb MNeises BSchirlin D Synthesis of peptidyl fluoromethyl ketones and peptidyl alpha-keto esters as inhibitors of porcine pancreatic elastase, human neutrophil elastase, and rat and human neutrophil cathepsin G. J Med Chem 33:394-407 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cathepsin G
Name:Cathepsin G
Synonyms:CG
Type:PROTEIN
Mol. Mass.:28860.08
Organism:Homo sapiens (Human)
Description:ChEMBL_1469016
Residue:255
Sequence:
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014746
n/a
NameBDBM50014746
Synonyms:3-({1-[2-(3-Methoxycarbonyl-propionylamino)-3-methyl-butyryl]-pyrrolidine-2-carbonyl}-amino)-2-oxo-4-phenyl-butyric acid methyl ester | CHEMBL130656
TypeSmall organic molecule
Emp. Form.C26H35N3O8
Mol. Mass.517.5714
SMILESCOC(=O)CCC(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)C(=O)OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: