Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic elastase
LigandBDBM50014738
Substrate/Competitorn/a
Meas. Tech.ChEMBL_64822
Ki 15±n/a nM
Citation Peet NPBurkhart JPAngelastro MRGiroux ELMehdi SBey PKolb MNeises BSchirlin D Synthesis of peptidyl fluoromethyl ketones and peptidyl alpha-keto esters as inhibitors of porcine pancreatic elastase, human neutrophil elastase, and rat and human neutrophil cathepsin G. J Med Chem 33:394-407 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Pancreatic elastase
Name:Pancreatic elastase
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 152345
Components:This complex has 2 components.
Component 1
Name:Pancreatic elastase
Synonyms:Elastase 1 | Elastase-1 | Pancreatic elastase
Type:Enzyme
Mol. Mass.:28827.71
Organism:Sus scrofa (Pig)
Description:P00772
Residue:266
Sequence:
MLRLLVVASLVLYGHSTQDFPETNARVVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTL
IRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDI
ALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVD
YAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGC
NVTRKPTVFTRVSAYISWINNVIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Pancreatic elastase
Synonyms:Elastase 2A | Elastase-2 | Elastase-2A
Type:PROTEIN
Mol. Mass.:28705.23
Organism:Sus scrofa
Description:ChEMBL_156951
Residue:269
Sequence:
MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014738
n/a
NameBDBM50014738
Synonyms:CHEMBL130253 | N-(Adamantyl-sulfonyl)-N-(methoxy succinate) lys-pro-val-trifluromethane
TypeSmall organic molecule
Emp. Form.C32H49F3N4O8S
Mol. Mass.706.814
SMILESCOC(=O)CCC(=O)NCCCC[C@H](NS(=O)(=O)C12CC3CC(CC(C3)C1)C2)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)C(F)(F)F |TLB:25:24:27:19.20.21,25:20:27:26.24.23,THB:23:22:19:26.24.25,23:24:19:27.22.21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: