Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-chymotrypsin
LigandBDBM50014743
Substrate/Competitorn/a
Meas. Tech.ChEMBL_216618
Ki 17±n/a nM
Citation Peet NPBurkhart JPAngelastro MRGiroux ELMehdi SBey PKolb MNeises BSchirlin D Synthesis of peptidyl fluoromethyl ketones and peptidyl alpha-keto esters as inhibitors of porcine pancreatic elastase, human neutrophil elastase, and rat and human neutrophil cathepsin G. J Med Chem 33:394-407 (1990) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Beta-chymotrypsin
Name:Beta-chymotrypsin
Synonyms:CTRB1 | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B | Synonyms=CTRB
Type:PROTEIN
Mol. Mass.:27713.98
Organism:Homo sapiens (Human)
Description:ChEMBL_10909
Residue:263
Sequence:
MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014743
n/a
NameBDBM50014743
Synonyms:CHEMBL132171 | N-(1-{2-[2-(1-Benzyl-3,3,3-trifluoro-2-oxo-propylcarbamoyl)-pyrrolidin-1-yl]-1-methyl-2-oxo-ethylcarbamoyl}-ethyl)-succinamic acid methyl ester
TypeSmall organic molecule
Emp. Form.C26H33F3N4O7
Mol. Mass.570.558
SMILESCOC(=O)CCC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: