Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50024475 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54604 |
---|
Ki | >1000±n/a nM |
---|
Citation | DeGraw, JI; Christie, PH; Kisliuk, RL; Gaumont, Y; Sirotnak, FM Synthesis and antifolate properties of 10-alkyl-5,10-dideaza analogues of methotrexate and tetrahydrofolic acid. J Med Chem33:673-7 (1990) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50024475 |
---|
n/a |
---|
Name | BDBM50024475 |
Synonyms: | 2-{4-[(2-Amino-4-oxo-1,4,5,6,7,8-hexahydro-quinazolin-6-ylmethyl)-amino]-benzoylamino}-pentanedioic acid | 2-{4-[(2-Amino-4-oxo-3,4,5,6,7,8-hexahydro-quinazolin-6-ylmethyl)-amino]-benzoylamino}-pentanedioic acid (H4-DDF) | CHEMBL279508 |
Type | Small organic molecule |
Emp. Form. | C21H25N5O6 |
Mol. Mass. | 443.4531 |
SMILES | Nc1nc2CCC(CNc3ccc(cc3)C(=O)NC(CCC(O)=O)C(O)=O)Cc2c(=O)[nH]1 |
Structure |
|