Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin receptor
LigandBDBM50016422
Substrate/Competitorn/a
Meas. Tech.ChEBML_49556
Ki>10000±n/a nM
Citation Charpentier BDurieux CMenant IRoques BP Investigation of peripheral cholecystokinin receptor heterogeneity by cyclic and related linear analogues of CCK26-33: synthesis and biological properties. J Med Chem 30:962-8 (1987) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin receptor
Name:Cholecystokinin receptor
Synonyms:Cholecystokinin peripheral | Cholecystokinin receptor type A
Type:Enzyme Catalytic Domain
Mol. Mass.:49676.37
Organism:RAT
Description:Cholecystokinin central 0 RAT::P30551
Residue:444
Sequence:
MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSALQI
LLYSIIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLK
DFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAAT
WCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLLPGIVM
VVAYGLISLELYQGIKFDASQKKSAKEKKPSTGSSTRYEDSDGCYLQKSRPPRKLELQQL
SSGSGGSRLNRIRSSSSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAE
KHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEE
DGRTIRALLSRYSYSHMSTSAPPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50016422
n/a
NameBDBM50016422
Synonyms:3-{[9-[2-Amino-3-(4-sulfooxy-phenyl)-propionylamino]-3-(1H-indol-3-ylmethyl)-2,5,8,11-tetraoxo-1,4,7,12tetraaza-cycloheptadecane-17-carbonyl]-amino}-N-(1-carbamoyl-2-phenyl-ethyl)-succinamic acid | CHEMBL439699
TypeSmall organic molecule
Emp. Form.C45H54N10O14S
Mol. Mass.991.034
SMILESN[C@@H](Cc1ccc(OS(O)(=O)=O)cc1)C(=O)N[C@H]1CC(=O)NCCCC[C@@H](NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)CNC1=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: