Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50018388
Substrate/Competitorn/a
Meas. Tech.ChEBML_154996
IC50 2±n/a nM
Citation Guthrie RWKaplan GLMennona FATilley JWKierstead RWMullin JGLeMahieu RAZawoiski SO'Donnell MCrowley H Pentadienyl carboxamide derivatives as antagonists of platelet-activating factor. J Med Chem 32:1820-35 (1989) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF Platelet activating factor | PAF-R | Platelet-activating factor receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39219.60
Organism:Homo sapiens (Human)
Description:PAF Platelet activating factor PTAFR HUMAN::P25105
Residue:342
Sequence:
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50018388
n/a
NameBDBM50018388
Synonyms:5,5-Bis-(3-methoxy-phenyl)-penta-2,4-dienoic acid (4-pyridin-3-yl-butyl)-amide | CHEMBL296149
TypeSmall organic molecule
Emp. Form.C28H30N2O3
Mol. Mass.442.5494
SMILES[#6]-[#8]-c1cccc(c1)-[#6](=[#6]\[#6]=[#6]\[#6](=O)-[#7]-[#6]-[#6]-[#6]-[#6]-c1cccnc1)\c1cccc(-[#8]-[#6])c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: