Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50018394
Substrate/Competitorn/a
Meas. Tech.ChEBML_154996
IC50 50±n/a nM
Citation Guthrie RWKaplan GLMennona FATilley JWKierstead RWMullin JGLeMahieu RAZawoiski SO'Donnell MCrowley H Pentadienyl carboxamide derivatives as antagonists of platelet-activating factor. J Med Chem 32:1820-35 (1989) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF Platelet activating factor | PAF-R | Platelet-activating factor receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39219.60
Organism:Homo sapiens (Human)
Description:PAF Platelet activating factor PTAFR HUMAN::P25105
Residue:342
Sequence:
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50018394
n/a
NameBDBM50018394
Synonyms:5,5-Bis-(3,4-dimethoxy-phenyl)-penta-2,4-dienoic acid (1-methyl-4-pyridin-3-yl-butyl)-amide | CHEMBL53372
TypeSmall organic molecule
Emp. Form.C31H36N2O5
Mol. Mass.516.6279
SMILES[#6]-[#8]-c1ccc(cc1-[#8]-[#6])-[#6](=[#6]/[#6]=[#6]/[#6](=O)-[#7]-[#6@H](-[#6])-[#6]-[#6]-[#6]-c1cccnc1)\c1ccc(-[#8]-[#6])c(-[#8]-[#6])c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: