| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50018478 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_53150 |
|---|
| Ki | 2.5±n/a nM |
|---|
| Citation |  Roth, B; Tidwell, MY; Ferone, R; Baccanari, DP; Sigel, CW; DeAngelis, D; Elwell, LP 2,4-Diamino-5-benzylpyrimidines as antibacterial agents. 13. Some alkenyl derivatives with high in vitro activity against anaerobic organisms. J Med Chem32:1949-58 (1989) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase (DfrB) | Tetrahydrofolate dehydrogenase | folA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18249.71 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | n/a |
|---|
| Residue: | 159 |
|---|
| Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
|---|
| BDBM50018478 |
|---|
| n/a |
|---|
| Name | BDBM50018478 |
|---|
| Synonyms: | 5-(3-Ethoxy-4,5-dimethoxy-benzyl)-pyrimidine-2,4-diamine | CHEMBL23609 | TCMDC-137664 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H20N4O3 |
|---|
| Mol. Mass. | 304.3443 |
|---|
| SMILES | CCOc1cc(Cc2cnc(N)nc2N)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
