| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50019100 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_153214 |
|---|
| Ki | 13±n/a nM |
|---|
| Citation |  Van Dort, ME; Ciliax, BJ; Gildersleeve, DL; Sherman, PS; Rosenspire, KC; Young, AB; Junck, L; Wieland, DM Radioiodinated benzodiazepines: agents for mapping glial tumors. J Med Chem31:2081-6 (1988) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50019100 |
|---|
| n/a |
|---|
| Name | BDBM50019100 |
|---|
| Synonyms: | 5-(4-Chloro-phenyl)-7-iodo-1-methyl-1,3-dihydro-benzo[e][1,4]diazepin-2-one | CHEMBL293009 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H12ClIN2O |
|---|
| Mol. Mass. | 410.637 |
|---|
| SMILES | CN1c2ccc(I)cc2C(=NCC1=O)c1ccc(Cl)cc1 |c:10| |
|---|
| Structure | 
|
|---|
Search and Browse
