| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50019482 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146984 |
|---|
| IC50 | 2.9±n/a nM |
|---|
| Citation |  Gairin, JE; Mazarguil, H; Alvinerie, P; Saint-Pierre, S; Meunier, JC; Cros, J Synthesis and biological activities of dynorphin A analogues with opioid antagonist properties. J Med Chem29:1913-7 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50019482 |
|---|
| n/a |
|---|
| Name | BDBM50019482 |
|---|
| Synonyms: | DYNORPHIN A (1-11) | NH2-Tyr-Gly-Gly-D-Trp-Leu-Arg-Arg-D-Trp-Arg-D-Pro-Lys-OH | dynorphin A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C63H103N21O13 |
|---|
| Mol. Mass. | 1362.6248 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
