Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM50021196
Substrate/Competitorn/a
Meas. Tech.ChEBML_33040
Ki 1.4±n/a nM
Citation Huff JRAnderson PSBaldwin JJClineschmidt BVGuare JPLotti VJPettibone DJRandall WCVacca JP N-(1,3,4,6,7,12b-hexahydro-2H-benzo[b]furo[2,3-a]quinolizin -2-yl)-N- methyl-2-hydroxyethane-sulfonamide: a potent and selective alpha 2-adrenoceptor antagonist. J Med Chem 28:1756-9 (1986) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
adrenergic Alpha2
Name:Cerebral cortex alpha adrenergic receptor
Synonyms:Alpha-2A adrenergic receptor | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | Alpha-2D adrenergic receptor | Alpha-2Da adrenergic receptor | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha2A | adrenergic Alpha2D
Type:Enzyme Catalytic Domain
Mol. Mass.:49275.13
Organism:BOVINE
Description:adrenergic Alpha2 0 BOVINE::Q28838
Residue:452
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISFEKKRGRSG
QPSAEPRCEINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDATA
AELPGSAERRPNGLGPERGGVGPVGAEVESLQVQLNGAPGEPAPAGAGADALDLEESSSS
EHAERPPGSRRSERGPRAKGKARASQVKPGDSLPRRGPGATGLGAPTAGPAEERSGGGAK
ASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAIGCPVPPTLFKFFFWFGYCN
SSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50021196
n/a
NameBDBM50021196
Synonyms:2-Hydroxy-ethanesulfonic acid (1,3,4,5,6,11b-hexahydro-2H-11-oxa-4a-aza-benzo[a]fluoren-2-yl)-methyl-amide | CHEMBL48558
TypeSmall organic molecule
Emp. Form.C18H24N2O4S
Mol. Mass.364.459
SMILESCN(C1CCN2CCc3c(oc4ccccc34)C2C1)S(=O)(=O)CCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: