| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50021495 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_145293 |
|---|
| Ki | 1.5±n/a nM |
|---|
| Citation |  Portoghese, PS; Larson, DL; Sayre, LM; Yim, CB; Ronsisvalle, G; Tam, SW; Takemori, AE Opioid agonist and antagonist bivalent ligands. The relationship between spacer length and selectivity at multiple opioid receptors. J Med Chem29:1855-61 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50021495 |
|---|
| n/a |
|---|
| Name | BDBM50021495 |
|---|
| Synonyms: | 1N,4N-di[4-cyclopropylmethyl-10,17-dihydroxy-(13R,14R,17S)-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7(18),8,10-trien-14-ylcarbamoylmethylcarbamoylmethyl]succinamide | CHEMBL3350130 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C52H66N8O12 |
|---|
| Mol. Mass. | 995.1268 |
|---|
| SMILES | [H][C@@]12Oc3c4c(C[C@H]5N(CC6CC6)CC[C@@]14[C@@]5(O)CC[C@H]2NC(=O)CNC(=O)CNC(=O)CCC(=O)NCC(=O)NCC(=O)N[C@@H]1CC[C@@]2(O)[C@H]4Cc5ccc(O)c6O[C@]1([H])[C@]2(CCN4CC1CC1)c56)ccc3O |TLB:65:64:48:69.52.51,THB:9:8:16:4.5.6| |
|---|
| Structure | 
|
|---|
Search and Browse
