Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlanine racemase
LigandBDBM50022058
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30520
Ki 2000000±n/a nM
Citation Vo-Quang YCarniato DVo-Quang LLacoste AMNeuzil ELe Goffic F (beta-Chloro-alpha-aminoethyl)phosphonic acids as inhibitors of alanine racemase and D-alanine:D-alanine ligase. J Med Chem 29:148-51 (1986) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alanine racemase
Name:Alanine racemase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39155.52
Organism:Escherichia coli (strain K12)
Description:ChEMBL_30522
Residue:359
Sequence:
MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVW
MKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNT
FCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022058
n/a
NameBDBM50022058
Synonyms:(1-Amino-2,2-dichloro-ethyl)-phosphonic acid | CHEMBL288476
TypeSmall organic molecule
Emp. Form.C2H6Cl2NO3P
Mol. Mass.193.954
SMILESNC(C(Cl)Cl)P(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: