Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPepsin A
LigandBDBM50017789
Substrate/Competitorn/a
Meas. Tech.ChEBML_222285
Ki 10±n/a nM
Citation Salituro FGAgarwal NHofmann TRich DH Inhibition of aspartic proteinases by peptides containing lysine and ornithine side-chain analogues of statine. J Med Chem 30:286-95 (1987) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Pepsin A
Name:Pepsin A
Synonyms:Pepsin | Pepsin A precursor
Type:Enzyme
Mol. Mass.:41232.87
Organism:Porcine
Description:n/a
Residue:385
Sequence:
MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPASKYFPEAAALI
GDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDS
STFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGIL
GLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNW
VPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENS
DGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWIL
GDVFIRQYYTVFDRANNKVGLAPVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50017789
n/a
NameBDBM50017789
Synonyms:(3S,4S)-3-Hydroxy-6-methyl-4-{3-methyl-2-[3-methyl-2-(3-methyl-butyrylamino)-butyrylamino]-butyrylamino}-heptanoic acid ethyl ester | 3-HYDROXY-6-METHYL-4-(3-METHYL-2-(3-METHYL-2-(3-METHYL-BUTYRYLAMINO)-BUTYRYLAMINO)-BUTYRYLAMINO)-HEPTANOIC ACID ETHYL ESTER | 3-Hydroxy-6-methyl-4-{3-methyl-2-[3-methyl-2-(3-methyl-butyrylamino)-butyrylamino]-butyrylamino}-heptanoic acid ethyl ester | CHEMBL433050
TypeSmall organic molecule
Emp. Form.C25H47N3O6
Mol. Mass.485.6572
SMILESCCOC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CC(C)C)C(C)C)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: