| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50023707 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54446 |
|---|
| IC50 | 63±n/a nM |
|---|
| Citation |  Rosowsky, A; Forsch, RA; Moran, RG; Kohler, W; Freisheim, JH Methotrexate analogues. 32. Chain extension, alpha-carboxyl deletion, and gamma-carboxyl replacement by sulfonate and phosphonate: effect on enzyme binding and cell-growth inhibition. J Med Chem31:1326-31 (1988) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MOUSE | Dhfr |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21608.82 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50023707 |
|---|
| n/a |
|---|
| Name | BDBM50023707 |
|---|
| Synonyms: | 2-{4-[(2,4-Diamino-pteridin-6-ylmethyl)-amino]-benzoylamino}-4-phosphono-butyric acid | CHEMBL27149 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H21N8O6P |
|---|
| Mol. Mass. | 476.3831 |
|---|
| SMILES | Nc1nc(N)c2nc(CNc3ccc(cc3)C(=O)NC(CCP(O)(O)=O)C(O)=O)cnc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
