Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 receptor
LigandBDBM50023750
Substrate/Competitorn/a
Meas. Tech.ChEBML_214849
Ki 1.6±n/a nM
Citation Moore MLAlbrightson CBrickson BBryan HGCaldwell NCallahan JFFoster JKinter LBNewlander KASchmidt DB Dicarbavasopressin antagonist analogues exhibit reduced in vivo agonist activity. J Med Chem 31:1487-9 (1988) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 receptor
Name:Vasopressin V2 receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40556.17
Organism:Sus scrofa
Description:ChEMBL_214870
Residue:370
Sequence:
MLRATTSAVPRALSWPAAPGNGSEREPLDDRDPLLARVELALLSTVFVAVALSNGLVLGA
LVRRGRRGRWAPMHVFIGHLCLADLAVALFQVLPQLAWDATYRFRGPDALCRAVKYLQMV
GMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQR
DVGDGSGVLDCWASFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHTSLVPGPA
ERAGGHRGGRRAGSPREGARVSAAMAKTARMTLVIVAVYVLCWAPFFLVQLWSVWDPKAP
REGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATA
SSFSARDTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50023750
n/a
NameBDBM50023750
Synonyms:1-[19-Benzyl-13-carbamoylmethyl-22-(4-ethoxy-benzyl)-16-isopropyl-12,15,18,21,24-pentaoxo-7,8-dithia-11,14,17,20,23-pentaaza-spiro[5.19]pentacosane-10-carbonyl]-pyrrolidine-2-carboxylic acid (1-carbamoyl-4-guanidino-butyl)-amide | CHEMBL2372280
TypeSmall organic molecule
Emp. Form.C52H79N15O10S2
Mol. Mass.1138.408
SMILES[#6]-[#6]-[#8]-c1ccc(-[#6]-[#6@H]-2-[#7]-[#6](=O)-[#6]C3([#6]-[#6]-[#6]-[#6]-[#6]3)[#16]-[#16]-[#6]-[#6](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@H](-[#6]-c3ccccc3)-[#7]-[#6]-2=O)-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](-[#7])=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: