| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50405400 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54594 |
|---|
| Ki | 0.003±n/a nM |
|---|
| Citation |  DeGraw, JI; Christie, PH; Tagawa, H; Kisliuk, RL; Gaumont, Y; Schmid, FA; Sirotnak, FM Synthesis and biological activity of resolved C-10 diastereomers of 10-methyl- and 10-ethyl-10-deazaminopterin. J Med Chem29:1056-61 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MOUSE | Dhfr |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21608.82 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50405400 |
|---|
| n/a |
|---|
| Name | BDBM50405400 |
|---|
| Synonyms: | CHEMBL2051987 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23N7O5 |
|---|
| Mol. Mass. | 453.4512 |
|---|
| SMILES | C[C@H](Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
