Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50405400 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54594 |
---|
Ki | 0.003±n/a nM |
---|
Citation | DeGraw, JI; Christie, PH; Tagawa, H; Kisliuk, RL; Gaumont, Y; Schmid, FA; Sirotnak, FM Synthesis and biological activity of resolved C-10 diastereomers of 10-methyl- and 10-ethyl-10-deazaminopterin. J Med Chem29:1056-61 (1986) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50405400 |
---|
n/a |
---|
Name | BDBM50405400 |
Synonyms: | CHEMBL2051987 |
Type | Small organic molecule |
Emp. Form. | C21H23N7O5 |
Mol. Mass. | 453.4512 |
SMILES | C[C@H](Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r| |
Structure |
|