Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50025846
Substrate/Competitorn/a
Meas. Tech.ChEBML_218507
Ki 320000±n/a nM
Citation Groutas WCAbrams WRTheodorakis MCKasper AMRude SABadger RCOcain TDMiller KEMoi MKBrubaker MJ Amino acid derived latent isocyanates: irreversible inactivation of porcine pancreatic elastase and human leukocyte elastase. J Med Chem 28:204-9 (1985) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50025846
n/a
NameBDBM50025846
Synonyms:2-[(Imidazole-1-carbonyl)-amino]-pentanoic acid methyl ester | CHEMBL306418
TypeSmall organic molecule
Emp. Form.C10H15N3O3
Mol. Mass.225.2444
SMILESCCC[C@H](NC(=O)n1ccnc1)C(=O)OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: