Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50025852 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_218507 |
---|
Ki | 1000000±n/a nM |
---|
Citation | Groutas, WC; Abrams, WR; Theodorakis, MC; Kasper, AM; Rude, SA; Badger, RC; Ocain, TD; Miller, KE; Moi, MK; Brubaker, MJ Amino acid derived latent isocyanates: irreversible inactivation of porcine pancreatic elastase and human leukocyte elastase. J Med Chem28:204-9 (1985) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50025852 |
---|
n/a |
---|
Name | BDBM50025852 |
Synonyms: | 2-[(Imidazole-1-carbonyl)-amino]-hexanoic acid methyl ester | CHEMBL293883 |
Type | Small organic molecule |
Emp. Form. | C11H17N3O3 |
Mol. Mass. | 239.271 |
SMILES | CCCCC(NC(=O)n1ccnc1)C(=O)OC |
Structure |
|