Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50025856 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_63792 |
---|
IC50 | 1620000±n/a nM |
---|
Citation | Groutas, WC; Stanga, MA; Brubaker, MJ; Huang, TL; Moi, MK; Carroll, RT Substituted 2-pyrones, 2-pyridones, and other congeners of elasnin as potential agents for the treatment of chronic obstructive lung diseases. J Med Chem28:1106-9 (1985) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50025856 |
---|
n/a |
---|
Name | BDBM50025856 |
Synonyms: | 6-(1-Butyl-heptyl)-4-hydroxy-pyran-2-one | CHEMBL12969 |
Type | Small organic molecule |
Emp. Form. | C16H26O3 |
Mol. Mass. | 266.3758 |
SMILES | CCCCCCC(CCCC)c1cc(O)cc(=O)o1 |
Structure |
|