Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen B |
---|
Ligand | BDBM50025859 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_216621 (CHEMBL819193) |
---|
Ki | 6500±n/a nM |
---|
Citation | Kinder, DH; Katzenellenbogen, JA Acylamino boronic acids and difluoroborane analogues of amino acids: potent inhibitors of chymotrypsin and elastase. J Med Chem28:1917-25 (1986) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen B |
---|
Name: | Chymotrypsinogen B |
Synonyms: | Beta-chymotrypsin | CTRB | CTRB1 | CTRB1_HUMAN | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B | Synonyms=CTRB |
Type: | PROTEIN |
Mol. Mass.: | 27713.98 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_10909 |
Residue: | 263 |
Sequence: | MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
|
|
|
BDBM50025859 |
---|
n/a |
---|
Name | BDBM50025859 |
Synonyms: | CHEMBL61146 | N-(2-phenyl ethyl)acetamide boronic acid |
Type | Small organic molecule |
Emp. Form. | C10H14BNO3 |
Mol. Mass. | 207.034 |
SMILES | CC(=O)NC(Cc1ccccc1)B(O)O |
Structure |
|