| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen B |
|---|
| Ligand | BDBM50025866 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_216621 (CHEMBL819193) |
|---|
| Ki | 270±n/a nM |
|---|
| Citation |  Kinder, DH; Katzenellenbogen, JA Acylamino boronic acids and difluoroborane analogues of amino acids: potent inhibitors of chymotrypsin and elastase. J Med Chem28:1917-25 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen B |
|---|
| Name: | Chymotrypsinogen B |
|---|
| Synonyms: | Beta-chymotrypsin | CTRB | CTRB1 | CTRB1_HUMAN | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B | Synonyms=CTRB |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27713.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_10909 |
|---|
| Residue: | 263 |
|---|
| Sequence: | MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
|
|
|
|---|
| BDBM50025866 |
|---|
| n/a |
|---|
| Name | BDBM50025866 |
|---|
| Synonyms: | CHEMBL60695 | N-[1R-(2-phenyl ethyl)]benzamide difluoroborane |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H14BF2NO |
|---|
| Mol. Mass. | 273.086 |
|---|
| SMILES | FB(F)[C@H](Cc1ccccc1)NC(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
