| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50026391 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_54600 |
|---|
| Ki | 0.00531±n/a nM |
|---|
| Citation |  Piper, JR; McCaleb, GS; Montgomery, JA; Schmid, FA; Sirotnak, FM Syntheses and evaluation as antifolates of MTX analogues derived from 2, omega-diaminoalkanoic acids. J Med Chem28:1016-25 (1985) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MOUSE | Dhfr |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21608.82 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50026391 |
|---|
| n/a |
|---|
| Name | BDBM50026391 |
|---|
| Synonyms: | 5-(4-Chloro-benzoylamino)-2-{4-[(2,4-diamino-pteridin-6-ylmethyl)-methyl-amino]-benzoylamino}-pentanoic acid | CHEMBL7624 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H28ClN9O4 |
|---|
| Mol. Mass. | 578.022 |
|---|
| SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)NC(CCCNC(=O)c1ccc(Cl)cc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
