Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50026389 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54600 |
---|
Ki | 0.004000±n/a nM |
---|
Citation | Piper, JR; McCaleb, GS; Montgomery, JA; Schmid, FA; Sirotnak, FM Syntheses and evaluation as antifolates of MTX analogues derived from 2, omega-diaminoalkanoic acids. J Med Chem28:1016-25 (1985) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50026389 |
---|
n/a |
---|
Name | BDBM50026389 |
Synonyms: | 2-{4-[(2,4-Diamino-pteridin-6-ylmethyl)-methyl-amino]-benzoylamino}-4-ureido-butyric acid | CHEMBL7684 |
Type | Small organic molecule |
Emp. Form. | C20H24N10O4 |
Mol. Mass. | 468.4692 |
SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)NC(CCNC(N)=O)C(O)=O |
Structure |
|