Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM18050
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54600
Ki 5.8±n/a nM
Citation Piper JRMcCaleb GSMontgomery JASchmid FASirotnak FM Syntheses and evaluation as antifolates of MTX analogues derived from 2, omega-diaminoalkanoic acids. J Med Chem 28:1016-25 (1985) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:21608.82
Organism:Mus musculus (Mouse)
Description:n/a
Residue:187
Sequence:
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18050
n/a
NameBDBM18050
Synonyms:2-[(4-{[(2,4-diaminopteridin-6-yl)methyl](methyl)amino}phenyl)formamido]pentanedioic acid | CHEMBL34259 | METHOTREXATE | MTX | Methotrexate | cid_126941
TypeSmall organic molecule
Emp. Form.C20H22N8O5
Mol. Mass.454.4393
SMILESCN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: