Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidine kinase, cytosolic
LigandBDBM50027352
Substrate/Competitorn/a
Meas. Tech.ChEMBL_207853
Ki 4100±n/a nM
Citation Schroeder ACBardos TJCheng YC Synthesis and antiviral activity of 1-(2-deoxy-beta-D-ribofuranosyl)-5-(methylmercapto)-2-pyrimidinone. J Med Chem 24:109-12 (1981) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Thymidine kinase, cytosolic
Name:Thymidine kinase, cytosolic
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:25476.50
Organism:Homo sapiens (Human)
Description:ChEMBL_1333884
Residue:234
Sequence:
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI
VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK
YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027352
n/a
NameBDBM50027352
Synonyms:1-(4,5-Dihydroxy-tetrahydro-furan-2-yl)-5-methylsulfanyl-1H-pyrimidin-2-one | CHEMBL268232
TypeSmall organic molecule
Emp. Form.C9H12N2O4S
Mol. Mass.244.268
SMILESCSc1cnc(=O)n(c1)C1CC(O)C(O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: