Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50027973 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54924 |
---|
Ki | 0.400000±n/a nM |
---|
Citation | Birdsall, B; Feeney, J; Pascual, C; Roberts, GC; Kompis, I; Then, RL; Müller, K; Kroehn, A A 1H NMR study of the interactions and conformations of rationally designed brodimoprim analogues in complexes with Lactobacillus casei dihydrofolate reductase. J Med Chem27:1672-6 (1985) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_LACCA | dhfR | folA |
Type: | PROTEIN |
Mol. Mass.: | 18437.08 |
Organism: | Lactobacillus casei |
Description: | ChEMBL_1357878 |
Residue: | 163 |
Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
BDBM50027973 |
---|
n/a |
---|
Name | BDBM50027973 |
Synonyms: | 6-[2-Bromo-5-(2,4-diamino-pyrimidin-5-ylmethyl)-3-methoxy-phenoxy]-hexanoic acid | CHEMBL286400 |
Type | Small organic molecule |
Emp. Form. | C18H23BrN4O4 |
Mol. Mass. | 439.304 |
SMILES | COc1cc(Cc2cnc(N)nc2N)cc(OCCCCCC(O)=O)c1Br |
Structure |
|