Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCHRM5
LigandBDBM50010859
Substrate/Competitorn/a
Meas. Tech.ChEBML_139742
IC50 300±n/a nM
Citation Griffith RCGentile RJRobichaud RCFrankenheim J cis-1,3,4,6,7,11b-Hexahydro-2-methyl-7-phenyl-2H-pyrazino[2,1-a] isoquinoline: a new atypical antidepressant. J Med Chem 27:995-1003 (1984) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
CHRM5
Name:Muscarinic acetylcholine receptor
Synonyms:Cholinergic, muscarinic M5 | Muscarinic acetylcholine receptor M5
Type:Enzyme Catalytic Domain
Mol. Mass.:60161.80
Organism:RAT
Description:Cholinergic, muscarinic M5 CHRM5 RAT::P08911
Residue:531
Sequence:
MEGESYNESTVNGTPVNHQALERHGLWEVITIAVVTAVVSLMTIVGNVLVMISFKVNSQL
KTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWVLGSLACDLWLALDYVASNASVMNL
LVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLVSFILWAPAILCWQYLVGKRTVPPD
ECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVAEAKK
REPAQRTLLRSFFSCPRPSLAQRERNQASWSSSRRSTSTTGKTTQATDLSADWEKAEQVT
TCSSYPSSEDEAKPTTDPVFQMVYKSEAKESPGKESNTQETKETVVNTRTENSDYDTPKY
FLSPAAAHRLKSQKCVAYKFRLVVKADGTQETNNGCRKVKIMPCSFPVSKDPSTKGPDPN
LSHQMTKRKRMVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGY
WLCYVNSTINPICYALCNRTFRKTFKLLLLCRWKKKKVEEKLYWQGNSKLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010859
n/a
NameBDBM50010859
Synonyms:CHEMBL11 | IMIPRAMINE HYDROCHLORIDE | IMIPRAMINE PAMOATE | Imipramin
TypeSmall organic molecule
Emp. Form.C19H24N2
Mol. Mass.280.4073
SMILESCN(C)CCCN1c2ccccc2CCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: