Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50028535 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_54593 |
---|
Ki | 208±n/a nM |
---|
Citation | Piper, JR; Montgomery, JA; Sirotnak, FM; Chello, PL Syntheses of alpha- and gamma-substituted amides, peptides, and esters of methotrexate and their evaluation as inhibitors of folate metabolism. J Med Chem25:182-7 (1982) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_MOUSE | Dhfr |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50028535 |
---|
n/a |
---|
Name | BDBM50028535 |
Synonyms: | CHEMBL55797 | derivative of methotrexate |
Type | Small organic molecule |
Emp. Form. | C24H27N9O8 |
Mol. Mass. | 569.5267 |
SMILES | CN(Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)NC(CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O |
Structure |
|