| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phenylethanolamine N-methyltransferase |
|---|
| Ligand | BDBM10758 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_142786 |
|---|
| Ki | 467000±n/a nM |
|---|
| Citation |  Rafferty, MF; Wilson, DS; Monn, JA; Krass, P; Borchardt, RT; Grunewald, GL Importance of the aromatic ring in adrenergic amines. 7. Comparison of the stereoselectivity of norepinephrine N-methyltransferase for aromatic vs. nonaromatic substrates and inhibitors. J Med Chem25:1198-204 (1983) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phenylethanolamine N-methyltransferase |
|---|
| Name: | Phenylethanolamine N-methyltransferase |
|---|
| Synonyms: | Noradrenaline N-methyltransferase | PNMT | PNMT_BOVIN | PNMTase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 30916.97 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 283 |
|---|
| Sequence: | MSGTDRSQAAGAVPDSDPGLAAVSSAYQRFEPRAYLRNNYAPPRGDLSCPDGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTIYQLLSACAHFEDITMTDFLEVNRQELRLWLREEPGA
FDWSVYSQHVCLIEGKGESWQEKECQLRARVKRILPIDVHRPQPLGAGGLAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLAVVPVREEEVR
EALVRTATRCGICARTPMPAHLQTGVDDVKGIFFTRAQKKVGV
|
|
|
|---|
| BDBM10758 |
|---|
| n/a |
|---|
| Name | BDBM10758 |
|---|
| Synonyms: | 14C-phenylethylamine | 2-phenylethan-1-amine | CHEMBL610 | phenylethylamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H11N |
|---|
| Mol. Mass. | 121.1796 |
|---|
| SMILES | NCCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
