Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSqualene synthetase
LigandBDBM50029168
Substrate/Competitorn/a
Meas. Tech.ChEMBL_202111
IC50 65±n/a nM
Citation Brown GRButlin RJChapman SEakin MAFoubister AJFreeman SGriffiths DHarrison PJJohnson MCMallion KB Phenoxypropylamines: a new series of squalene synthase inhibitors. J Med Chem 38:4157-60 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Squalene synthetase
Name:Squalene synthetase
Synonyms:FPP:FPP farnesyltransferase | Farnesyl-diphosphate farnesyltransferase | SQS | SS
Type:PROTEIN
Mol. Mass.:48109.41
Organism:Rattus norvegicus
Description:ChEMBL_1336736
Residue:416
Sequence:
MEFVKCLGHPEEFYNLLRFRMGGRRNFIPKMDRNSLSNSLKTCYKYLDQTSRSFAAVIQA
LDGDIRHAVCVFYLILRAMDTVEDDMAISVEKKIPLLRNFHTFLYEPEWRFTESKEKHRV
VLEDFPTISLEFRNLAEKYQTVIADICHRMGCGMAEFLNKDVTSKQDWDKYCHYVAGLVG
IGLSRLFSASEFEDPIVGEDTECANSMGLFLQKTNIIRDYLEDQQEGRQFWPQEVWGKYV
KKLEDFVKPENVDVAVKCLNELITNALQHIPDVITYLSRLRNQSVFNFCAIPQVMAIATL
AACYNNHQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIYQYIEEIYHRVPNSDPSASKAK
QLISNIRTQSLPNCQLISRSHYSPIYLSFIMLLAALSWQYLSTLSQVTEDYVQREH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029168
n/a
NameBDBM50029168
Synonyms:CHEMBL133996 | N-[3-Allyl-4-(3-isopropylamino-propoxy)-phenyl]-acetamide
TypeSmall organic molecule
Emp. Form.C17H26N2O2
Mol. Mass.290.4005
SMILESCC(C)NCCCOc1ccc(NC(C)=O)cc1CC=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: