Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin receptor ET-A
LigandBDBM50407615
Substrate/Competitorn/a
Meas. Tech.ChEMBL_65814
IC50 18±n/a nM
Citation Fukami TNagase TFujita KHayama TNiiyama KMase TNakajima SFukuroda TSaeki TNishikibe M Structure-activity relationships of cyclic pentapeptide endothelin A receptor antagonists. J Med Chem 38:4309-24 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Endothelin receptor ET-A
Name:Endothelin receptor ET-A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:48707.29
Organism:Sus scrofa
Description:ChEMBL_65803
Residue:427
Sequence:
METFCFRVSFWVALLGCVISDNPESHSTNLSTHVDDFTTFRGTEFSLVVTTHRPTNLALP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFENHDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEEHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHEQNNHNTERS
SHKDSIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50407615
n/a
NameBDBM50407615
Synonyms:CHEMBL343516
TypeSmall organic molecule
Emp. Form.C32H42N6O8
Mol. Mass.638.7113
SMILESCC(C)C[C@H]1NC(=O)[C@@H](NC(=O)[C@H]2CCCN2C(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc2cn(C=O)c3ccccc23)NC1=O)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: