Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombin
LigandBDBM50029515
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210582
IC50 18±n/a nM
Citation Shuman RTRothenberger RBCampbell CSSmith GFGifford-Moore DSPaschal JWGesellchen PD Structure-activity study of tripeptide thrombin inhibitors using alpha-alkyl amino acids and other conformationally constrained amino acid substitutions. J Med Chem 38:4446-53 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Thrombin
Name:Thrombin
Synonyms:Activation peptide fragment 1 | Activation peptide fragment 2 | Coagulation factor II | Prothrombin | Thrombin heavy chain | Thrombin light chain
Type:Enzyme
Mol. Mass.:70502.73
Organism:Bos taurus (Bovine)
Description:P00735
Residue:625
Sequence:
MARVRGPRLPGCLALAALFSLVHSQHVFLAHQQASSLLQRARRANKGFLEEVRKGNLERE
CLEEPCSREEAFEALESLSATDAFWAKYTACESARNPREKLNECLEGNCAEGVGMNYRGN
VSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTTSPTLRRE
ECSVPVCGQDRVTVEVIPRSGGSTTSQSPLLETCVPDRGREYRGRLAVTTSGSRCLAWSS
EQAKALSKDQDFNPAVPLAENFCRNPDGDEEGAWCYVADQPGDFEYCDLNYCEEPVDGDL
GDRLGEDPDPDAAIEGRTSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFE
SYIEGRIVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNF
TVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDY
IHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCK
ASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRD
GKYGFYTHVFRLKKWIQKVIDRLGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029515
n/a
NameBDBM50029515
Synonyms:CHEMBL141584 | tert-butyloxy carbonyl-D-Phe-azetidine-2-carboxylate-Arg-H
TypeSmall organic molecule
Emp. Form.C24H36N6O6
Mol. Mass.504.5792
SMILESCC(C)(C)OC(=O)N[C@@H](Cc1ccccc1)C(=O)N1CC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: