Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 reverse transcriptase
LigandBDBM50004152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195839
IC50>6000±n/a nM
Citation Dollé VFan ENguyen CHAubertin AMKirn AAndreola MLJamieson GTarrago-Litvak LBisagni E A new series of pyridinone derivatives as potent non-nucleoside human immunodeficiency virus type 1 specific reverse transcriptase inhibitors. J Med Chem 38:4679-86 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 reverse transcriptase
Name:Human immunodeficiency virus type 1 reverse transcriptase
Synonyms:Reverse transcriptase/RNaseH
Type:PROTEIN
Mol. Mass.:65229.15
Organism:Human immunodeficiency virus 1
Description:ChEMBL_1473730
Residue:566
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004152
n/a
NameBDBM50004152
Synonyms:(HEPT) 1-(2-Hydroxy-ethoxymethyl)-5-methyl-6-phenylsulfanyl-1H-pyrimidine-2,4-dione | 1-((2-hydroxyethoxy)methyl)-5-methyl-6-(phenylthio)pyrimidine-2,4(1H,3H)-dione | 1-(2-HYDROXYETHYLOXYMETHYL)-6-PHENYL THIOTHYMINE | 1-(2-Hydroxy-ethoxymethyl)-5-methyl-6-phenylsulfanyl-1H-pyrimidine-2,4-dione | 1-(2-Hydroxy-ethoxymethyl)-5-methyl-6-phenylsulfanyl-1H-pyrimidine-2,4-dione(HEPT) | 1-[(2-hydroxyethoxy)methyl]-6-(phenylsulfanyl)thymine | 1-[(2-hydroxyethoxy)methyl]-6-(phenylthio)-thymine | CHEMBL31871
TypeSmall organic molecule
Emp. Form.C14H16N2O4S
Mol. Mass.308.353
SMILESCc1c(Sc2ccccc2)n(COCCO)c(=O)[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: