Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 reverse transcriptase
LigandBDBM50029672
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195839
IC50>4000±n/a nM
Citation Dollé VFan ENguyen CHAubertin AMKirn AAndreola MLJamieson GTarrago-Litvak LBisagni E A new series of pyridinone derivatives as potent non-nucleoside human immunodeficiency virus type 1 specific reverse transcriptase inhibitors. J Med Chem 38:4679-86 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 reverse transcriptase
Name:Human immunodeficiency virus type 1 reverse transcriptase
Synonyms:Reverse transcriptase/RNaseH
Type:PROTEIN
Mol. Mass.:65229.15
Organism:Human immunodeficiency virus 1
Description:ChEMBL_1473730
Residue:566
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029672
n/a
NameBDBM50029672
Synonyms:CHEMBL341880 | N-[4-(3,5-Dimethyl-phenylsulfanyl)-5-methyl-2-oxo-1,2-dihydro-pyridin-3-yl]-acetamide
TypeSmall organic molecule
Emp. Form.C16H18N2O2S
Mol. Mass.302.391
SMILESCC(=O)Nc1c(Sc2cc(C)cc(C)c2)c(C)c[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: