Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50029695
Substrate/Competitorn/a
Meas. Tech.ChEMBL_64004
Ki 0.052±n/a nM
Citation Hlasta DJAckerman JHCourt JJFarrell RPJohnson JAKofron JLRobinson DTTalomie TGDunlap RPFranke CA A novel class of cyclic beta-dicarbonyl leaving groups and their use in the design of benzisothiazolone human leukocyte elastase inhibitors. J Med Chem 38:4687-92 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029695
n/a
NameBDBM50029695
Synonyms:4-Isopropyl-6-methoxy-1,1-dioxo-2-(5-oxo-2,5-dihydro-furan-3-yloxymethyl)-1,2-dihydro-1lambda*6*-benzo[d]isothiazol-3-one | CHEMBL343599
TypeSmall organic molecule
Emp. Form.C16H17NO7S
Mol. Mass.367.374
SMILESCOc1cc2c(C(=O)N(COC3=CC(=O)OC3)S2(=O)=O)c(c1)C(C)C |t:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: