Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4B
LigandBDBM14361
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157198
Ki 221±n/a nM
Citation Brackeen MFCowan DJStafford JASchoenen FJVeal JMDomanico PLRose DStrickland ABVerghese MFeldman PL Design and synthesis of conformationally constrained analogues of 4-(3-butoxy-4-methoxybenzyl)imidazolidin-2-one (Ro 20-1724) as potent inhibitors of cAMP-specific phosphodiesterase. J Med Chem 38:4848-54 (1996) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4B
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4B
Synonyms:DPDE4 | Isoform PDE4B1 | PDE32 | PDE4B1 | Phosphodiesterase 4B | Phosphodiesterase 4B (PDE4B) | Phosphodiesterase 4B (PDE4B1) | Phosphodiesterase Type 4 (PDE4B)
Type:Protein
Mol. Mass.:83318.87
Organism:Homo sapiens (Human)
Description:Q07343-1
Residue:736
Sequence:
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14361
n/a
NameBDBM14361
Synonyms:(R,S)-Rolipram | 4-(3-cyclopentyloxy-4-methoxy-phenyl)pyrrolidin-2-one | 4-[3-(cyclopentyloxy)-4-methoxyphenyl]pyrrolidin-2-one | Adeo | CHEMBL63 | Rolipram
TypeSmall organic molecule
Emp. Form.C16H21NO3
Mol. Mass.275.3428
SMILESCOc1ccc(cc1OC1CCCC1)C1CNC(=O)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: