Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50030217 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_195686 (CHEMBL800603) |
---|
IC50 | 6600±n/a nM |
---|
Citation | Mohan, P; Loya, S; Avidan, O; Verma, S; Dhindsa, GS; Wong, MF; Huang, PP; Yashiro, M; Baba, M; Hizi, A Synthesis of naphthalenesulfonic acid small molecules as selective inhibitors of the DNA polymerase and ribonuclease H activities of HIV-1 reverse transcriptase. J Med Chem37:2513-9 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50030217 |
---|
n/a |
---|
Name | BDBM50030217 |
Synonyms: | CHEMBL313213 | Hexadecanoic acid 1-hexadecanoylamino-4-sulfo-naphthalen-2-yl ester |
Type | Small organic molecule |
Emp. Form. | C42H69NO6S |
Mol. Mass. | 716.065 |
SMILES | CCCCCCCCCCCCCCCC(=O)Nc1c(OC(=O)CCCCCCCCCCCCCCC)cc(c2ccccc12)S(O)(=O)=O |
Structure |
|