Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II type 1a (AT-1a) receptor
LigandBDBM50030729
Substrate/Competitorn/a
Meas. Tech.ChEMBL_36952
IC50 0.120000±n/a nM
Citation Chang LLAshton WTFlanagan KLChen TBO'Malley SSZingaro GJKivlighn SDSiegl PKLotti VJChang RS Potent and orally active angiotensin II receptor antagonists with equal affinity for human AT1 and AT2 subtypes. J Med Chem 38:3741-58 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II type 1a (AT-1a) receptor
Name:Angiotensin II type 1a (AT-1a) receptor
Synonyms:ANGIOTENSIN AT1 | Angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41009.15
Organism:RABBIT
Description:ANGIOTENSIN AT1 AGTR1 RABBIT::P34976
Residue:359
Sequence:
MMLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLAVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSSKKPVPCFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030729
n/a
NameBDBM50030729
Synonyms:CHEMBL124771 | N-{4-Bromo-3-[3-butyl-4-(3-fluoro-2-(N-t-butyloxycarbonyl)-Sulfanamido-biphenyl-4-ylmethyl)-5-oxo-4,5-dihydro-[1,2,4]triazol-1-yl]-phenyl}-propionamide
TypeSmall organic molecule
Emp. Form.C33H37BrFN5O6S
Mol. Mass.730.644
SMILESCCCCc1nn(-c2cc(NC(=O)CC)ccc2Br)c(=O)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OC(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: