Reaction Details |
| Report a problem with these data |
Target | Cellular retinoic acid-binding protein 2 |
---|
Ligand | BDBM31883 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_52402 (CHEMBL665905) |
---|
Kd | 2±n/a nM |
---|
Citation | Alam, M; Zhestkov, V; Sani, BP; Venepally, P; Levin, AA; Kazmer, S; Li, E; Norris, AW; Zhang, XK; Lee, MO Conformationally defined 6-s-trans-retinoic acid analogs. 2. Selective agonists for nuclear receptor binding and transcriptional activity. J Med Chem38:2302-10 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cellular retinoic acid-binding protein 2 |
---|
Name: | Cellular retinoic acid-binding protein 2 |
Synonyms: | Cellular retinoic acid-binding protein II | Crabp2 | RABP2_MOUSE |
Type: | PROTEIN |
Mol. Mass.: | 15744.92 |
Organism: | Mus musculus |
Description: | ChEMBL_52402 |
Residue: | 138 |
Sequence: | MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVR
TTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGEL
ILTMTADDVVCTRVYVRE
|
|
|
BDBM31883 |
---|
n/a |
---|
Name | BDBM31883 |
Synonyms: | 9-cis-retinoic acid (9cRA) | ALL-TRANS-RETINOIC ACID | AT-RA | Atralin | CHEMBL38 | MLS000028588 | SMR000058245 | TRETINOIN | Vitamin A acid | [3H]RA | [3H]Retinoic acid | [3H]Vitamin A acid | [3H]tretinoin | all-trans retinoic acid | cid_444795 |
Type | radiolabeled ligand |
Emp. Form. | C20H28O2 |
Mol. Mass. | 300.4351 |
SMILES | C\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C/C(O)=O |c:4| |
Structure |
|