| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cellular retinoic acid-binding protein 1 |
|---|
| Ligand | BDBM50031457 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_52265 (CHEMBL665218) |
|---|
| IC50 | >500000±n/a nM |
|---|
| Citation |  Alam, M; Zhestkov, V; Sani, BP; Venepally, P; Levin, AA; Kazmer, S; Li, E; Norris, AW; Zhang, XK; Lee, MO Conformationally defined 6-s-trans-retinoic acid analogs. 2. Selective agonists for nuclear receptor binding and transcriptional activity. J Med Chem38:2302-10 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cellular retinoic acid-binding protein 1 |
|---|
| Name: | Cellular retinoic acid-binding protein 1 |
|---|
| Synonyms: | CRABP1 | Cellular retinoic acid-binding protein I | RABP1_CHICK | cellular retinoic acid binding protein 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15660.02 |
|---|
| Organism: | Gallus gallus |
|---|
| Description: | ChEMBL_52265 |
|---|
| Residue: | 137 |
|---|
| Sequence: | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVR
TTEINFKIGESFEEETVDGRKCRSLATWENENKIYCKQTLIEGDGPKTYWTRELANDELI
LTFGADDVVCTRIYVRE
|
|
|
|---|
| BDBM50031457 |
|---|
| n/a |
|---|
| Name | BDBM50031457 |
|---|
| Synonyms: | (2Z,5E)-3-{(E)-3-[3-Ethyl-2-isopropyl-cyclohex-2-en-(E)-ylidene]-2-methyl-propenyl}-5-methyl-hepta-2,5-dienoic acid | CHEMBL72988 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H34O2 |
|---|
| Mol. Mass. | 342.5149 |
|---|
| SMILES | CCC1=C(C(C)C)\C(CCC1)=C\C(\C)=C\C(\C\C(C)=C\C)=C/C(O)=O |c:2| |
|---|
| Structure | 
|
|---|
Search and Browse
