Reaction Details |
| Report a problem with these data |
Target | Cellular retinoic acid-binding protein 1 |
---|
Ligand | BDBM50031457 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_52265 (CHEMBL665218) |
---|
IC50 | >500000±n/a nM |
---|
Citation | Alam, M; Zhestkov, V; Sani, BP; Venepally, P; Levin, AA; Kazmer, S; Li, E; Norris, AW; Zhang, XK; Lee, MO Conformationally defined 6-s-trans-retinoic acid analogs. 2. Selective agonists for nuclear receptor binding and transcriptional activity. J Med Chem38:2302-10 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cellular retinoic acid-binding protein 1 |
---|
Name: | Cellular retinoic acid-binding protein 1 |
Synonyms: | CRABP1 | Cellular retinoic acid-binding protein I | RABP1_CHICK | cellular retinoic acid binding protein 1 |
Type: | PROTEIN |
Mol. Mass.: | 15660.02 |
Organism: | Gallus gallus |
Description: | ChEMBL_52265 |
Residue: | 137 |
Sequence: | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVR
TTEINFKIGESFEEETVDGRKCRSLATWENENKIYCKQTLIEGDGPKTYWTRELANDELI
LTFGADDVVCTRIYVRE
|
|
|
BDBM50031457 |
---|
n/a |
---|
Name | BDBM50031457 |
Synonyms: | (2Z,5E)-3-{(E)-3-[3-Ethyl-2-isopropyl-cyclohex-2-en-(E)-ylidene]-2-methyl-propenyl}-5-methyl-hepta-2,5-dienoic acid | CHEMBL72988 |
Type | Small organic molecule |
Emp. Form. | C23H34O2 |
Mol. Mass. | 342.5149 |
SMILES | CCC1=C(C(C)C)\C(CCC1)=C\C(\C)=C\C(\C\C(C)=C\C)=C/C(O)=O |c:2| |
Structure |
|