Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein-1 (KLK1)
LigandBDBM50031709
Substrate/Competitorn/a
Meas. Tech.ChEMBL_92381
IC50>100000±n/a nM
Citation Senokuchi KNakai HNakayama YOdagaki YSakaki KKato MMaruyama TMiyazaki TIto HKamiyasu K New orally active serine protease inhibitors. J Med Chem 38:2521-3 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Kallikrein-1 (KLK1)
Name:Kallikrein 1
Synonyms:Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein
Type:Enzyme
Mol. Mass.:28874.69
Organism:Homo sapiens (Human)
Description:P06870
Residue:262
Sequence:
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031709
n/a
NameBDBM50031709
Synonyms:4-Guanidino-benzoic acid 4-carboxymethyl-phenyl ester; compound with methanesulfonic acid | CHEMBL433135
TypeSmall organic molecule
Emp. Form.C16H15N3O4
Mol. Mass.313.308
SMILES[#7]\[#6](-[#7])=[#7]/c1ccc(cc1)-[#6](=O)-[#8]-c1ccc(-[#6]-[#6](-[#8])=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: