Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasmin
LigandBDBM50031706
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155580
IC50 2620±n/a nM
Citation Senokuchi KNakai HNakayama YOdagaki YSakaki KKato MMaruyama TMiyazaki TIto HKamiyasu K New orally active serine protease inhibitors. J Med Chem 38:2521-3 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Plasmin
Name:Plasminogen
Synonyms:Plg
Type:Protein
Mol. Mass.:90541.87
Organism:Rattus norvegicus
Description:Q01177
Residue:812
Sequence:
MDHKEIILLFLLFLKPGQGDSLDGYVSTQGASLHSLTKKQLAAGSIADCLAKCEGETDFI
CRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTGIGKGYRGTMSKTKT
GVTCQKWSDTSPHVPKYSPSTHPSEGLEENYCRNPDNDEQGPWCYTTDPDQRYEYCNIPE
CEEECMYCSGEKYEGKISKTMSGLDCQSWDSQSPHAHGYIPAKFPSKNLKMNYCRNPDGE
PRPWCFTTDPNKRWEYCDIPRCTTPPPPPGPTYQCLKGRGENYRGTVSVTASGKTCQRWS
EQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIPSCGSSVSPDQ
SDSSVLPEQTPVVQECYQGNGKSYRGTSSTTNTGKKCQSWVSMTPHSHSKTPANFPDAGL
EMNYCRNPDNDQRGPWCFTTDPSVRWEYCNLKRCSETGGGVAESAIVPQVPSAPGTSETD
CMYGNGKEYRGKTAVTAAGTPCQEWAAQEPHSHRIFTPQTNPRAGLEKNYCRNPDGDVNG
PWCYTMNPRKLYDYCNIPLCASLSSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQISLR
TRFSGQHFCGGTLISPEWVLTAAHCLEKSSRPEFYKVILGAHEERILGSDVQQIAVTKLV
LEPNDADIALLKLSRPATITDNVIPACLPSPNYVVADRTLCYITGWGETKGTPGAGRLKE
AQLPVIENKVCNRAEYLNNRVKSTELCAGHLAGGIDSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSRYVNWIEREMRND
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031706
n/a
NameBDBM50031706
Synonyms:4-Guanidino-benzoic acid 4-dimethylcarbamoylmethoxycarbonylmethyl-phenyl ester; compound with methanesulfonic acid | CHEMBL85164
TypeSmall organic molecule
Emp. Form.C20H22N4O5
Mol. Mass.398.4125
SMILES[#6]-[#7](-[#6])-[#6](=O)-[#6]-[#8]-[#6](=O)-[#6]-c1ccc(-[#8]-[#6](=O)-c2ccc(cc2)\[#7]=[#6](/[#7])-[#7])cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: